PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma122g00780.1
Common NameZOSMA_122G00780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 201aa    MW: 23797.5 Da    PI: 10.3671
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma122g00780.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-1846102157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       r+k +++ +eq+e Le++F++n+ p++++r +L +++++++r+Vk+WFqNrR+k+kk
  Zosma122g00780.1  46 RSKYQRHHPEQIEKLERFFQRNSLPNERQRFDLGMEIKMDTRKVKYWFQNRRTKMKK 102
                       6788999*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1736104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-1739106IPR009057Homeodomain-like
PROSITE profilePS5007115.77543103IPR001356Homeobox domain
SMARTSM003894.4E-1345107IPR001356Homeobox domain
PfamPF000465.7E-1646102IPR001356Homeobox domain
CDDcd000866.13E-1246104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MEQGKMNVMK NGSGSGAIEC VENKQQLTIE EGSRSLIVVT DNTAVRSKYQ RHHPEQIEKL  60
ERFFQRNSLP NERQRFDLGM EIKMDTRKVK YWFQNRRTKM KKQQEQRESA VLKRQNIRYF  120
AENVYLREKL RNPICTICGD ASECKEIPVE AFQLQVENIR LREELQRLSL LRMEILNNNP  180
MFRKSGAMLG KLLFQRRDQV *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193102QNRRTKMKKQ
294101NRRTKMKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9Q2Y51e-146A0A0K9Q2Y5_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.13e-32HD-ZIP family protein